PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G2168
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 314aa    MW: 35270 Da    PI: 6.6658
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G2168genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++lv+++k+ G g+W++ ++  g++R++k+c++rw +yl
      Gh_D11G2168 14 KGPWTLEEDQKLVKYIKENGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding56.18.8e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
      Gh_D11G2168  67 RGKFSQEEEQTILNLHSILGNK-WSAIASHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.782961IPR017930Myb domain
SuperFamilySSF466893.41E-3111108IPR009057Homeodomain-like
SMARTSM007171.7E-141363IPR001005SANT/Myb domain
PfamPF002492.4E-161461IPR001005SANT/Myb domain
CDDcd001672.00E-111661No hitNo description
PROSITE profilePS5129426.72962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.4E-2865117IPR009057Homeodomain-like
SMARTSM007174.9E-1766114IPR001005SANT/Myb domain
PfamPF002491.6E-1667112IPR001005SANT/Myb domain
CDDcd001677.43E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTLE EDQKLVKYIK ENGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEQTILN LHSILGNKWS AIASHLPGRT DNEIKNFWNT HLRKKLIQMG  120
IDPMTHRPRI DIFSSLPHLI ALANLKELMD QQQPWEEAAQ MAKLQCLQYL LQNPPSISSP  180
SNNMHTTFTD METMDISNSL LISPPQLASV PGLDDSIPFS RLPDLQIPCD YRISSSSKDD  240
TAQAQAQKHA MLSQGENTCN STWLPSPSAV PSVTETLISN LGDASCSSNF DVAAPSVWLD  300
DHQLFQDPLF HNLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-29121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488260.10.0PREDICTED: myb-related protein 330
TrEMBLA0A0D2SIU40.0A0A0D2SIU4_G
STRINGPOPTR_0007s05360.11e-136(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-100myb domain protein 93